McDonnell Genome Institute

Washington University

Transcript

lnc-TLK1-5:1

Chromosome

chr2

Gene Name

lnc-TLK1-5

Start

171374930

CPC Label

coding

End

171375278

Cancer

OV

Strand

-

Peptide

DISEVSVFNAYVLPK

Modified Peptide

n[145]DISEVSVFNAYVLPK

Peptide Length

15

ORF Length

99

Open Reading Frame (ORF)

MTKKRRNNGHAKKGRGHVHPIRCTNCTRCVPKDKAIKKFVIRNVVEAAAVRDISEVSVFNAYVLPKLYVKLYYCVSCAIHSKVVRNRSREAHKDRTPPP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.727173

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9309

PhyloCSF Frame 3

0

CNTI Score

-0.311105878