McDonnell Genome Institute

Washington University

Transcript

lnc-TLK1-2:2

Chromosome

chr2

Gene Name

lnc-TLK1-2

Start

171318652

CPC Label

noncoding

End

171321011

Cancer

OV

Strand

-

Peptide

VFAQTCLDGK

Modified Peptide

n[145]VFAQTCLDGK

Peptide Length

10

ORF Length

50

Open Reading Frame (ORF)

LREVEELSIEWNGVRSEISGKEDHIKVFAQTCLDGKSSKVQLSSFLFKHA

Conservation Score

1

PhyloCSF Frame 1

-5.091

No. of Spectra

51

CPC Coding Probability

0.0567107

PhyloCSF Frame 2 

-4.265

CNTI Index

noncoding

Max Probability

0.9349

PhyloCSF Frame 3

-4.495

CNTI Score

-0.414552477