McDonnell Genome Institute

Washington University

Transcript

lnc-TLE3-15:2

Chromosome

chr15

Gene Name

lnc-TLE3-15

Start

69748532

CPC Label

noncoding

End

69755582

Cancer

OSCC

Strand

-

Peptide

AILHSMLNK

Modified Peptide

n[145]AILHSMLNK

Peptide Length

9

ORF Length

60

Open Reading Frame (ORF)

LSFLWLEGWCFLARDHKAILHSMLNKQMFESVFYWFHTICHLVWGSKENCGFVGCVCVCV

Conservation Score

1

PhyloCSF Frame 1

-2.906

No. of Spectra

3

CPC Coding Probability

0.0330281

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9585

PhyloCSF Frame 3

0

CNTI Score

-0.377414586