McDonnell Genome Institute

Washington University

Transcript

lnc-TLE3-11:1

Chromosome

chr15

Gene Name

lnc-TLE3-11

Start

70251865

CPC Label

noncoding

End

70261330

Cancer

OV

Strand

-

Peptide

CLGQCLQSPGGAGR

Modified Peptide

n[145]CLGQCLQSPGGAGR

Peptide Length

14

ORF Length

193

Open Reading Frame (ORF)

LSLGPAPTQQPNCLYSKISFSEVTWTQGSHTHSYVSTLKHTNTYGHTITPGHTHTSTHTLKSKCTQPHRQHTHKCLGQCLQSPGGAGRLPPCAGGWRCGSPLAPVTFKDRAQRPTAGVPSLGPLSLSRFRLSERNTHHPASFLFPLQPREDGPKAEPCLLAVAKAPFSLYHVFKTNFACVVPNPLKQPSPSSP

Conservation Score

0.113

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.0273656

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.575

PhyloCSF Frame 3

0

CNTI Score

-0.355969466