McDonnell Genome Institute

Washington University

Transcript

lnc-TLE1-9:1

Chromosome

chr9

Gene Name

lnc-TLE1-9

Start

80357028

CPC Label

noncoding

End

80360338

Cancer

OV

Strand

-

Peptide

GDPLGFLQAMASEPPVGNSR

Modified Peptide

n[145]GDPLGFLQAMASEPPVGNSR

Peptide Length

20

ORF Length

79

Open Reading Frame (ORF)

LFNPRRPPRPSSPGSLCGTPCPLPHYKGDPLGFLQAMASEPPVGNSRRLPHPGSLRTLLLAARSPTHCLHHLSRSQPGF

Conservation Score

0.018

PhyloCSF Frame 1

-5.341

No. of Spectra

3

CPC Coding Probability

0.435452

PhyloCSF Frame 2 

-4.432

CNTI Index

noncoding

Max Probability

0.8993

PhyloCSF Frame 3

-4.224

CNTI Score

-0.296454927