McDonnell Genome Institute

Washington University

Transcript

lnc-TLCD1-1:1

Chromosome

chr17

Gene Name

lnc-TLCD1-1

Start

28721486

CPC Label

noncoding

End

28722877

Cancer

BRCA-Luminal A

Strand

-

Peptide

SSLVAGGAGR

Modified Peptide

n[145]SSLVAGGAGR

Peptide Length

10

ORF Length

41

Open Reading Frame (ORF)

LITSGLSTTVTQLSPFKVTLDSRSSLVAGGAGRQSVNCFPI

Conservation Score

0.077

PhyloCSF Frame 1

0

No. of Spectra

33

CPC Coding Probability

0.0956474

PhyloCSF Frame 2 

-3.863

CNTI Index

noncoding

Max Probability

0.9955

PhyloCSF Frame 3

0

CNTI Score

-0.315290598