McDonnell Genome Institute

Washington University

Transcript

lnc-TIPIN-2:1

Chromosome

chr15

Gene Name

lnc-TIPIN-2

Start

66314913

CPC Label

noncoding

End

66331703

Cancer

PRAD

Strand

-

Peptide

FTLGTGK

Modified Peptide

Peptide Length

7

ORF Length

58

Open Reading Frame (ORF)

MFTLGTGKVLHMSYLHFFFFLRYGVSLCHPGWSTVVQSRLTASSTSWVHVILLPQPLE

Conservation Score

0.083

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.089738

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2847

PhyloCSF Frame 3

0

CNTI Score

-0.396894043