McDonnell Genome Institute

Washington University

Transcript

lnc-TIMP4-4:1

Chromosome

chr3

Gene Name

lnc-TIMP4-4

Start

12123646

CPC Label

noncoding

End

12125582

Cancer

PRAD

Strand

-

Peptide

LSFFLFSLR

Modified Peptide

Peptide Length

9

ORF Length

43

Open Reading Frame (ORF)

LSFFLFSLRQGLALSARLECSGVIMAHCSLNLPGSRDPPTLAY

Conservation Score

0.017

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.052382

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0869

PhyloCSF Frame 3

0

CNTI Score

-0.362978787