McDonnell Genome Institute

Washington University

Transcript

lnc-TIMP3-10:1

Chromosome

chr22

Gene Name

lnc-TIMP3-10

Start

33921312

CPC Label

noncoding

End

33923637

Cancer

HCC

Strand

+

Peptide

LHWSISTLNVEK

Modified Peptide

n[230]LHWSISTLNVEK

Peptide Length

12

ORF Length

45

Open Reading Frame (ORF)

LHWSISTLNVEKLCFIKSRLQVPAVSGIANALNDINVVRLKCATY

Conservation Score

0.402

PhyloCSF Frame 1

-4.379

No. of Spectra

14

CPC Coding Probability

0.0203878

PhyloCSF Frame 2 

-3.98

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-5.07

CNTI Score

-0.285841668