McDonnell Genome Institute

Washington University

Transcript

lnc-TIMM9-3:1

Chromosome

chr14

Gene Name

lnc-TIMM9-3

Start

58574298

CPC Label

noncoding

End

58595109

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LYGFVAQGLETTVL

Modified Peptide

n[145]LYGFVAQGLETTVL

Peptide Length

14

ORF Length

45

Open Reading Frame (ORF)

MDPTGGRAQAVMLTHLLLTSCWVAQFLTGHRLYGFVAQGLETTVL

Conservation Score

0.632

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.38215

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.347026459