McDonnell Genome Institute

Washington University

Transcript

lnc-TIMM23-2:2

Chromosome

chr10

Gene Name

lnc-TIMM23-2

Start

46030736

CPC Label

noncoding

End

46031425

Cancer

OV

Strand

+

Peptide

IELIGREQWLTPVIPARWGPR

Modified Peptide

n[145]IELIGREQWLTPVIPARWGPR

Peptide Length

21

ORF Length

56

Open Reading Frame (ORF)

LKANLVPRTILSDSDGLTRIELIGREQWLTPVIPARWGPRRANHEVGRWRASWLTR

Conservation Score

0.053

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.15901

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5881

PhyloCSF Frame 3

0

CNTI Score

-0.36209341