McDonnell Genome Institute

Washington University

Transcript

lnc-TIMM21-5:12

Chromosome

chr18

Gene Name

lnc-TIMM21-5

Start

72867826

CPC Label

coding

End

72881399

Cancer

CCRC

Strand

+

Peptide

ICPSGIPNAK

Modified Peptide

ICPSGIPNAK

Peptide Length

10

ORF Length

81

Open Reading Frame (ORF)

LGSAARPARAQREDAAANPEPDPRAGRKAWKREGPSCENPLWGLVFHFLKAYNLGFITTYIRIEVHEQKICPSGIPNAKLK

Conservation Score

1

PhyloCSF Frame 1

-0.809

No. of Spectra

1

CPC Coding Probability

0.522147

PhyloCSF Frame 2 

-0.349

CNTI Index

noncoding

Max Probability

0.0554

PhyloCSF Frame 3

-1.485

CNTI Score

-0.306572243