McDonnell Genome Institute

Washington University

Transcript

lnc-TIGIT-7:1

Chromosome

chr3

Gene Name

lnc-TIGIT-7

Start

114622441

CPC Label

noncoding

End

114624372

Cancer

OSCC

Strand

+

Peptide

DSPSFQK

Modified Peptide

n[145]DSPSFQK

Peptide Length

7

ORF Length

60

Open Reading Frame (ORF)

LEVSAYENHIGDIKDSPSFQKAIHFRCCHTIECFYGHHVFLVFVSSFVFSMLNEHARFLK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.0269694

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9729

PhyloCSF Frame 3

0

CNTI Score

-0.321844379