McDonnell Genome Institute

Washington University

Transcript

lnc-TIGD5-1:1

Chromosome

chr8

Gene Name

lnc-TIGD5-1

Start

143601245

CPC Label

noncoding

End

143603224

Cancer

OV

Strand

+

Peptide

HVGSHLSSQHFGRLR

Modified Peptide

n[145]HVGSHLSSQHFGRLR

Peptide Length

15

ORF Length

99

Open Reading Frame (ORF)

LSPSPSMATFYKQGSTNFCYKIKEARHVGSHLSSQHFGRLRRVDHLRLGVRDQPGQHGENPVSTKNTKISWAWWQVPVTLATQEAEAREMLEARRQRLQ

Conservation Score

0.095

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.102834

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4593

PhyloCSF Frame 3

0

CNTI Score

-0.283816289