McDonnell Genome Institute

Washington University

Transcript

lnc-TIGD4-2:1

Chromosome

chr4

Gene Name

lnc-TIGD4-2

Start

152934519

CPC Label

noncoding

End

152936837

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

STVGVGR

Modified Peptide

n[145]STVGVGR

Peptide Length

7

ORF Length

63

Open Reading Frame (ORF)

LAMQLVLQTRVHTGASSPPGTDRCSPWPVTWGASEKQVVKENIPGKPADRKSTVGVGRRPLRG

Conservation Score

0.595

PhyloCSF Frame 1

-1.339

No. of Spectra

13

CPC Coding Probability

0.0613018

PhyloCSF Frame 2 

-3.935

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

-3.704

CNTI Score

-0.350910294