McDonnell Genome Institute

Washington University

Transcript

lnc-TIGD1-1:3

Chromosome

chr2

Gene Name

lnc-TIGD1-1

Start

232595766

CPC Label

coding

End

232611971

Cancer

OSCC

Strand

-

Peptide

LACGNLHK

Modified Peptide

n[145]LACGNLHK

Peptide Length

8

ORF Length

127

Open Reading Frame (ORF)

LACGNLHKSGATWSQEVFDRLPPAGCCGNHMADGSWCPLEGVSDFLRSWNLCGLGRQTELFCPGGGSCKCKRGSITRCRAGGTAGPPIPVESSDPFLHFSVRSCSVTQAGVCGAIMPHSSLDIPRLR

Conservation Score

0.953

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.610178

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.975

PhyloCSF Frame 3

0

CNTI Score

-0.332790306