McDonnell Genome Institute

Washington University

Transcript

lnc-TIGD1-1:12

Chromosome

chr2

Gene Name

lnc-TIGD1-1

Start

232581192

CPC Label

noncoding

End

232586489

Cancer

OV

Strand

-

Peptide

LLEVSWK

Modified Peptide

n[145]LLEVSWK

Peptide Length

7

ORF Length

56

Open Reading Frame (ORF)

LDILRAAGASCGPCSLAGDPSVRCTSTNCWNGDFFFFLSYLSQNDLDGKLLEVSWK

Conservation Score

0.191

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0480414

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9561

PhyloCSF Frame 3

0

CNTI Score

-0.369704537