McDonnell Genome Institute

Washington University

Transcript

lnc-TIFA-2:1

Chromosome

chr4

Gene Name

lnc-TIFA-2

Start

111826880

CPC Label

noncoding

End

112072698

Cancer

EOGC

Strand

-

Peptide

AIIEADSLTTTQEVAEELNVDLSTVVWHLK

Modified Peptide

n[145]AIIEADSLTTTQEVAEELNVDLSTVVWHLK

Peptide Length

30

ORF Length

150

Open Reading Frame (ORF)

LNHVFPGMSKINWSFNLAILTRTEGEQRIKQENKADYIKRTETMEMMLDKKQIPAIFLFEFKMGHKAVKTTCHINNTFGSGTANKCTVQWWFKFCKGDKSLEDEEHSGWPSEVDKDQMKAIIEADSLTTTQEVAEELNVDLSTVVWHLKQ

Conservation Score

0.752

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.109784

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4716

PhyloCSF Frame 3

0

CNTI Score

-0.338593258