McDonnell Genome Institute

Washington University

Transcript

lnc-TICRR-1:1

Chromosome

chr15

Gene Name

lnc-TICRR-1

Start

89518522

CPC Label

noncoding

End

89591956

Cancer

OV

Strand

+

Peptide

IKNELGVVAR

Modified Peptide

n[145]IKNELGVVAR

Peptide Length

10

ORF Length

39

Open Reading Frame (ORF)

LKSGVRDQPDQHGETPSLLKIKNELGVVARVCNPSYSGG

Conservation Score

0.154

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0485512

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9585

PhyloCSF Frame 3

0

CNTI Score

-0.408323811