McDonnell Genome Institute

Washington University

Transcript

lnc-TICAM1-1:2

Chromosome

chr19

Gene Name

lnc-TICAM1-1

Start

4791744

CPC Label

noncoding

End

4795555

Cancer

HCC

Strand

-

Peptide

ASARPWAGRR

Modified Peptide

n[230]ASARPWAGRR

Peptide Length

10

ORF Length

83

Open Reading Frame (ORF)

MSSGVPPPATSPVSSSSSSRLRPLSSFWSSCSLPSRAALYTAVRRSMVRASARPWAGRRGTGRRRIRARTGGRQPSPSPSPPS

Conservation Score

1

PhyloCSF Frame 1

0.066

No. of Spectra

2

CPC Coding Probability

0.353945

PhyloCSF Frame 2 

-2.152

CNTI Index

noncoding

Max Probability

0.7332

PhyloCSF Frame 3

10.739

CNTI Score

-0.212043817