McDonnell Genome Institute

Washington University

Transcript

lnc-TIA1-1:1

Chromosome

chr2

Gene Name

lnc-TIA1-1

Start

70182788

CPC Label

noncoding

End

70190953

Cancer

CCRC

Strand

-

Peptide

LGLLGTGSER

Modified Peptide

n[230]LGLLGTGSER

Peptide Length

10

ORF Length

48

Open Reading Frame (ORF)

LGLLGTGSERSRGEDAGKQVPGDMCVSLQTHPGSRPGGERPGVGRPLR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0534154

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0.882

CNTI Score

-0.309932984