McDonnell Genome Institute

Washington University

Transcript

lnc-THUMPD1-2:2

Chromosome

chr16

Gene Name

lnc-THUMPD1-2

Start

20701899

CPC Label

coding

End

20731552

Cancer

BRCA-Luminal B

Strand

-

Peptide

TIIPVLAR

Modified Peptide

n[145]TIIPVLAR

Peptide Length

8

ORF Length

82

Open Reading Frame (ORF)

LRVLGHLRRACRPTGEINGHWFLTSCFHTAVLFRGGSAKYGWTPRWWYEEIEEEHCNNYQYLCGLILITGRTIIPVLARHCG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.775996

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

8.88

CNTI Score

-0.355085443