McDonnell Genome Institute

Washington University

Transcript

lnc-THSD7B-3:1

Chromosome

chr2

Gene Name

lnc-THSD7B-3

Start

136544711

CPC Label

noncoding

End

136545542

Cancer

OV

Strand

+

Peptide

DVSIVAFYK

Modified Peptide

n[145]DVSIVAFYK

Peptide Length

9

ORF Length

68

Open Reading Frame (ORF)

MKSWKNIFSLSTGEKMLSSLAAMALVLALPLYKPTPFYFRDKVDAAVDFKDVSIVAFYKYEQTEILSS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.122061

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8857

PhyloCSF Frame 3

0

CNTI Score

-0.406729494