McDonnell Genome Institute

Washington University

Transcript

lnc-THRB-4:1

Chromosome

chr3

Gene Name

lnc-THRB-4

Start

24074977

CPC Label

noncoding

End

24078251

Cancer

OV

Strand

-

Peptide

INTIDRPLARLTK

Modified Peptide

n[145]INTIDRPLARLTK

Peptide Length

13

ORF Length

100

Open Reading Frame (ORF)

LGYSTGSANRKVHSLNASIKKTERAQTDILRSHFKELEKQEQTKPKTSRRKEITKIRTELNEIETKKIQKINEIKSWLFEKINTIDRPLARLTKKRREKI

Conservation Score

0.773

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.114958

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.523

PhyloCSF Frame 3

0

CNTI Score

-0.350569387