McDonnell Genome Institute

Washington University

Transcript

lnc-THRB-3:1

Chromosome

chr3

Gene Name

lnc-THRB-3

Start

24496271

CPC Label

noncoding

End

24499580

Cancer

HCC

Strand

-

Peptide

LLMLSAGVGGLSPLSLGR

Modified Peptide

n[230]LLMLSAGVGGLSPLSLGR

Peptide Length

18

ORF Length

33

Open Reading Frame (ORF)

LLMLSAGVGGLSPLSLGRSEEARIKHTCHWLEI

Conservation Score

0.023

PhyloCSF Frame 1

-4.156

No. of Spectra

3

CPC Coding Probability

0.0690166

PhyloCSF Frame 2 

-4.664

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

-4.51

CNTI Score

-0.346893593