McDonnell Genome Institute

Washington University

Transcript

lnc-THOC7-2:3

Chromosome

chr3

Gene Name

lnc-THOC7-2

Start

63767066

CPC Label

noncoding

End

63783099

Cancer

OV

Strand

-

Peptide

TPFLSTGYTLK

Modified Peptide

n[145]TPFLSTGYTLK

Peptide Length

11

ORF Length

34

Open Reading Frame (ORF)

MYTIRTPFLSTGYTLKAELRMSHAGLRMTRQQTL

Conservation Score

1

PhyloCSF Frame 1

-4.292

No. of Spectra

6

CPC Coding Probability

0.0190215

PhyloCSF Frame 2 

-3.791

CNTI Index

noncoding

Max Probability

0.9036

PhyloCSF Frame 3

-6.401

CNTI Score

-0.542236528