McDonnell Genome Institute

Washington University

Transcript

lnc-THOC3-2:6

Chromosome

chr5

Gene Name

lnc-THOC3-2

Start

176173351

CPC Label

noncoding

End

176199295

Cancer

BRCA-Basal-like

Strand

-

Peptide

SLTCGALGR

Modified Peptide

n[145]SLTCGALGR

Peptide Length

9

ORF Length

95

Open Reading Frame (ORF)

LGMAKTTSGAPRLLTKSLTCGALGRSVKALNILRLPHCLEAPDTREFPVGPPAEPDDPGRPGSDVPLWMIPTPCCGFSPSRCCVFWGPCQLPSKC

Conservation Score

0.192

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.0991366

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

0

CNTI Score

-0.349405489