McDonnell Genome Institute

Washington University

Transcript

lnc-THOC3-2:17

Chromosome

chr5

Gene Name

lnc-THOC3-2

Start

176173221

CPC Label

noncoding

End

176182795

Cancer

PRAD

Strand

-

Peptide

QSALSSSMAAVSEGK

Modified Peptide

‚Äč

Peptide Length

15

ORF Length

33

Open Reading Frame (ORF)

LYTSRQSALSSSMAAVSEGKFPVFTPQIEMVWR

Conservation Score

0.088

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.184492

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8826

PhyloCSF Frame 3

0

CNTI Score

-0.352626402