McDonnell Genome Institute

Washington University

Transcript

lnc-THOC3-2:15

Chromosome

chr5

Gene Name

lnc-THOC3-2

Start

176180006

CPC Label

noncoding

End

176185156

Cancer

CCRC

Strand

-

Peptide

FGQFGIK

Modified Peptide

n[230]FGQFGIK

Peptide Length

7

ORF Length

59

Open Reading Frame (ORF)

LRRKVCILGALLSKERPSVLQNVALTSLLLLERHFGLSFLTEMRFGQFGIKNTESSKEL

Conservation Score

0.105

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.04841

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

0

CNTI Score

-0.384642768