McDonnell Genome Institute

Washington University

Transcript

lnc-THOC2-8:3

Chromosome

chrX

Gene Name

lnc-THOC2-8

Start

123180637

CPC Label

noncoding

End

123514511

Cancer

CCRC

Strand

-

Peptide

YLISASTR

Modified Peptide

n[230]YLISASTR

Peptide Length

8

ORF Length

55

Open Reading Frame (ORF)

LSGSSTELEFQPSWKYLISASTRKRTIKARGRNEKHLQGFFGPLKYLVSAFQDYG

Conservation Score

0.982

PhyloCSF Frame 1

-5.108

No. of Spectra

1

CPC Coding Probability

0.0375431

PhyloCSF Frame 2 

-4.971

CNTI Index

noncoding

Max Probability

0.9559

PhyloCSF Frame 3

-4.322

CNTI Score

-0.343561332