McDonnell Genome Institute

Washington University

Transcript

lnc-THOC2-8:1

Chromosome

chrX

Gene Name

lnc-THOC2-8

Start

122872201

CPC Label

noncoding

End

123514530

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LACMALIK

Modified Peptide

n[145]LACMALIK

Peptide Length

8

ORF Length

90

Open Reading Frame (ORF)

LFFRDPRLFTTLAILLWMCSSLSNVTLKVWRPGLSTTLFLIYLALCPERLACMALIKEFPCLPTSGWVQLAGGQKSGGECGSLFPHFPLC

Conservation Score

0.168

PhyloCSF Frame 1

-5.58

No. of Spectra

22

CPC Coding Probability

0.0705136

PhyloCSF Frame 2 

-4.701

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

-4.775

CNTI Score

-0.343561332