McDonnell Genome Institute

Washington University

Transcript

lnc-THOC2-5:6

Chromosome

chrX

Gene Name

lnc-THOC2-5

Start

123958789

CPC Label

noncoding

End

123960286

Cancer

BRCA-Basal-like

Strand

-

Peptide

GGPIPSK

Modified Peptide

n[145]GGPIPSK

Peptide Length

7

ORF Length

54

Open Reading Frame (ORF)

LFVSNPVYWTFDRQELFTRGRKTRGGPIPSKAPLFPWTGRSDLLQCLHCCYRSS

Conservation Score

1

PhyloCSF Frame 1

-3.631

No. of Spectra

425

CPC Coding Probability

0.0295679

PhyloCSF Frame 2 

-4.519

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-2.865

CNTI Score

-0.364012476