McDonnell Genome Institute

Washington University

Transcript

lnc-THOC1-1:1

Chromosome

chr18

Gene Name

lnc-THOC1-1

Start

423743

CPC Label

noncoding

End

424416

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

EMALKLDIR

Modified Peptide

n[145]EM[147]ALKLDIR

Peptide Length

9

ORF Length

45

Open Reading Frame (ORF)

LETRFSGSYECSSVAPPFSLPFGRSKRLSSRMREMREMALKLDIR

Conservation Score

1

PhyloCSF Frame 1

-3.732

No. of Spectra

13

CPC Coding Probability

0.0270575

PhyloCSF Frame 2 

-4.906

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-5.105

CNTI Score

-0.439358613