McDonnell Genome Institute

Washington University

Transcript

lnc-THEM4-1:1

Chromosome

chr1

Gene Name

lnc-THEM4-1

Start

151941093

CPC Label

noncoding

End

151941496

Cancer

CCRC

Strand

-

Peptide

QAGQLER

Modified Peptide

n[230]QAGQLER

Peptide Length

7

ORF Length

38

Open Reading Frame (ORF)

LCVYVCVCVCERERERERQAGQLERESNDLDRFPQQQA

Conservation Score

0.073

PhyloCSF Frame 1

-5.451

No. of Spectra

19

CPC Coding Probability

0.0354859

PhyloCSF Frame 2 

-2.836

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

-5.449

CNTI Score

-0.466862913