McDonnell Genome Institute

Washington University

Transcript

lnc-THEGL-1:1

Chromosome

chr4

Gene Name

lnc-THEGL-1

Start

56622788

CPC Label

noncoding

End

56626211

Cancer

OSCC

Strand

+

Peptide

KSIMIWTMK

Modified Peptide

n[145]KSIM[147]IWTM[147]K

Peptide Length

9

ORF Length

90

Open Reading Frame (ORF)

LVPVEWGTAETIPKNVEETLELGNRQRLEQFGGLRRSQENVGKFGLPRDLLNGFDKKSIMIWTMKSRLKLSQMEMRNLLGTGAKATLVMF

Conservation Score

0.619

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.334375

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6443

PhyloCSF Frame 3

0

CNTI Score

-0.326402417