McDonnell Genome Institute

Washington University

Transcript

lnc-THBS2-5:1

Chromosome

chr6

Gene Name

lnc-THBS2-5

Start

168962609

CPC Label

noncoding

End

168964341

Cancer

OV

Strand

-

Peptide

MSTGVGQAPVEVQGK

Modified Peptide

n[145]MSTGVGQAPVEVQGK

Peptide Length

15

ORF Length

33

Open Reading Frame (ORF)

MSTGVGQAPVEVQGKESKTQTDGLRQSSEVYQT

Conservation Score

0.187

PhyloCSF Frame 1

-4.873

No. of Spectra

2

CPC Coding Probability

0.0215495

PhyloCSF Frame 2 

-4.317

CNTI Index

noncoding

Max Probability

0.911

PhyloCSF Frame 3

-4.231

CNTI Score

-0.37022122