McDonnell Genome Institute

Washington University

Transcript

lnc-THBS2-11:1

Chromosome

chr6

Gene Name

lnc-THBS2-11

Start

169115605

CPC Label

noncoding

End

169130310

Cancer

OV

Strand

-

Peptide

ASFEWEK

Modified Peptide

n[145]ASFEWEK

Peptide Length

7

ORF Length

118

Open Reading Frame (ORF)

MGQEGDLPLESGHLQADSSLKSCCQAIPQKSSCCSSMSGCFFSSLLLSALCQSGQGHRMWGRGRPWMVFKKASFEWEKQRCKVLSLGSSSRLEGGTIARDPVLFCLEFLCILCLSVFF

Conservation Score

0.527

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.363676

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8662

PhyloCSF Frame 3

0

CNTI Score

-0.344645331