McDonnell Genome Institute

Washington University

Transcript

lnc-THBS1-7:2

Chromosome

chr15

Gene Name

lnc-THBS1-7

Start

39167807

CPC Label

noncoding

End

39169807

Cancer

OV

Strand

+

Peptide

EDTTWMQIR

Modified Peptide

n[145]EDTTWMQIR

Peptide Length

9

ORF Length

51

Open Reading Frame (ORF)

LYFICMEMSSARVLLREDTTWMQIRAEKAPSSYNGPCWVFGEANYLREKQA

Conservation Score

0.279

PhyloCSF Frame 1

-5.236

No. of Spectra

51

CPC Coding Probability

0.034086

PhyloCSF Frame 2 

-4.87

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-6.124

CNTI Score

-0.444831833