McDonnell Genome Institute

Washington University

Transcript

lnc-THBS1-6:1

Chromosome

chr15

Gene Name

lnc-THBS1-6

Start

39383840

CPC Label

noncoding

End

39392637

Cancer

EOGC

Strand

+

Peptide

QPAHALRLEEEGER

Modified Peptide

n[145]QPAHALRLEEEGER

Peptide Length

14

ORF Length

53

Open Reading Frame (ORF)

LWRPKGATVRQPNVSTEMKEIGPKQPAHALRLEEEGERNLWREALTSGSSGTE

Conservation Score

0.114

PhyloCSF Frame 1

-5.792

No. of Spectra

1

CPC Coding Probability

0.0463995

PhyloCSF Frame 2 

-4.846

CNTI Index

noncoding

Max Probability

0.6001

PhyloCSF Frame 3

-4.171

CNTI Score

-0.373096603