McDonnell Genome Institute

Washington University

Transcript

lnc-THBD-4:1

Chromosome

chr20

Gene Name

lnc-THBD-4

Start

22885669

CPC Label

noncoding

End

22886068

Cancer

OSCC

Strand

-

Peptide

LEVTLLQTLR

Modified Peptide

n[145]LEVTLLQTLR

Peptide Length

10

ORF Length

37

Open Reading Frame (ORF)

LEVTLLQTLRMLGTLQMLGNCPKHISLRSSIQMINLS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0202344

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6899

PhyloCSF Frame 3

0

CNTI Score

-0.356382535