McDonnell Genome Institute

Washington University

Transcript

lnc-THAP9-3:1

Chromosome

chr4

Gene Name

lnc-THAP9-3

Start

82691736

CPC Label

noncoding

End

82692468

Cancer

GBM

Strand

+

Peptide

LGPWSLEGWCCR

Modified Peptide

n[230]LGPWSLEGWCCR

Peptide Length

12

ORF Length

60

Open Reading Frame (ORF)

LGPWSLEGWCCRSRSAVTSRGLRLPMASLARCVWCYWCLIFYRHSSGLEGILSHLSCSRA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0356759

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9432

PhyloCSF Frame 3

0

CNTI Score

-0.303909925