McDonnell Genome Institute

Washington University

Transcript

lnc-THAP9-2:1

Chromosome

chr4

Gene Name

lnc-THAP9-2

Start

82775460

CPC Label

noncoding

End

82776101

Cancer

EOGC

Strand

+

Peptide

LHHCVNCAIHSK

Modified Peptide

n[145]LHHCVNCAIHSK

Peptide Length

12

ORF Length

70

Open Reading Frame (ORF)

LQLSETFLKQASSTPMCFLSVKLHHCVNCAIHSKVVRTSSHEGRKDKESNTFIPIYICTCCPTTSTKAHV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

86

CPC Coding Probability

0.0924697

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.343865334