McDonnell Genome Institute

Washington University

Transcript

lnc-THAP7-20:1

Chromosome

chr22

Gene Name

lnc-THAP7-20

Start

21008636

CPC Label

coding

End

21014292

Cancer

EOGC

Strand

-

Peptide

VSAHEAALGGLR

Modified Peptide

n[145]VSAHEAALGGLR

Peptide Length

12

ORF Length

163

Open Reading Frame (ORF)

LLSVPRECPRAEPAARWPGAPDVDLLENQLGVAGAQALCAALTVNQAMRKMQLSGNGLEEQAAQHLAELLLAHTDLKSLDLSYNQLNDQAGRSVHGTAGLPHLPQLWGRHWLWVRVSAHEAALGGLREEVQAGVCHLPSPPGLHGHDGALQLHPDHLHDPGTF

Conservation Score

1

PhyloCSF Frame 1

1.247

No. of Spectra

1

CPC Coding Probability

0.739442

PhyloCSF Frame 2 

7.259

CNTI Index

coding

Max Probability

0.9999

PhyloCSF Frame 3

-4.608

CNTI Score

0.784073711