McDonnell Genome Institute

Washington University

Transcript

lnc-THAP6-3:1

Chromosome

chr4

Gene Name

lnc-THAP6-3

Start

75048085

CPC Label

noncoding

End

75050113

Cancer

OSCC

Strand

+

Peptide

LSLAVARQSTENPSGLR

Modified Peptide

n[145]LSLAVARQSTENPSGLR

Peptide Length

17

ORF Length

34

Open Reading Frame (ORF)

LSLAVARQSTENPSGLRDSRGSATFYNLPTHTLE

Conservation Score

0.022

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0364822

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6816

PhyloCSF Frame 3

0

CNTI Score

-0.374219031