McDonnell Genome Institute

Washington University

Transcript

lnc-THAP3-3:1

Chromosome

chr1

Gene Name

lnc-THAP3-3

Start

7092726

CPC Label

noncoding

End

7094456

Cancer

LUAD

Strand

+

Peptide

LEFGLQLR

Modified Peptide

n[230]LEFGLQLR

Peptide Length

8

ORF Length

67

Open Reading Frame (ORF)

LEFGLQLRRGCHSGSCLTRMTFWNIHRAKRPHPEAQGVCLAEEGRWVSDVVKSGFESWLRHSVALRL

Conservation Score

0.549

PhyloCSF Frame 1

-2.737

No. of Spectra

3

CPC Coding Probability

0.0754968

PhyloCSF Frame 2 

-3.216

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0.239

CNTI Score

-0.359221567