McDonnell Genome Institute

Washington University

Transcript

lnc-THAP2-2:1

Chromosome

chr12

Gene Name

lnc-THAP2-2

Start

71448404

CPC Label

noncoding

End

71448850

Cancer

OSCC

Strand

+

Peptide

LLLCDYENQIK

Modified Peptide

n[145]LLLCDYENQIK

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

LLLCDYENQIKISIEDVIFLNELFCIYIEVFTINIYFTVFVE

Conservation Score

0.757

PhyloCSF Frame 1

-5.59

No. of Spectra

7

CPC Coding Probability

0.0110183

PhyloCSF Frame 2 

-3.15

CNTI Index

noncoding

Max Probability

0.5516

PhyloCSF Frame 3

-4.288

CNTI Score

-0.644845389