McDonnell Genome Institute

Washington University

Transcript

lnc-THAP12-1:4

Chromosome

chr11

Gene Name

lnc-THAP12-1

Start

76442072

CPC Label

noncoding

End

76444680

Cancer

OSCC

Strand

-

Peptide

IEASCLILK

Modified Peptide

n[145]IEASCLILK

Peptide Length

9

ORF Length

43

Open Reading Frame (ORF)

LFLFHLICGEGLFVPILQVRKGAQYIVICGHKIEASCLILKIQ

Conservation Score

1

PhyloCSF Frame 1

-4.639

No. of Spectra

5

CPC Coding Probability

0.0298088

PhyloCSF Frame 2 

-1.857

CNTI Index

noncoding

Max Probability

0.9777

PhyloCSF Frame 3

-4.551

CNTI Score

-0.354938591