McDonnell Genome Institute

Washington University

Transcript

lnc-TH-1:1

Chromosome

chr11

Gene Name

lnc-TH-1

Start

2206660

CPC Label

noncoding

End

2211057

Cancer

OV

Strand

-

Peptide

TLSEGGAYPFPIMVWTR

Modified Peptide

n[145]TLSEGGAYPFPIMVWTR

Peptide Length

17

ORF Length

47

Open Reading Frame (ORF)

MTLSEGGAYPFPIMVWTRRCGASPTSYNWGRLTTTVEGTPWNSQTTS

Conservation Score

0.087

PhyloCSF Frame 1

-2.78

No. of Spectra

5

CPC Coding Probability

0.311443

PhyloCSF Frame 2 

-5.337

CNTI Index

noncoding

Max Probability

0.5239

PhyloCSF Frame 3

-4.44

CNTI Score

-0.241850035