McDonnell Genome Institute

Washington University

Transcript

lnc-TGIF2-1:4

Chromosome

chr20

Gene Name

lnc-TGIF2-1

Start

36550793

CPC Label

noncoding

End

36551444

Cancer

OV

Strand

+

Peptide

LGNSQSGHPFDAASPK

Modified Peptide

n[145]LGNSQSGHPFDAASPK

Peptide Length

16

ORF Length

60

Open Reading Frame (ORF)

LGNSQSGHPFDAASPKGVGGGSQSVPGYWPHMPDTRVIRSSQQSHCSTKGISGRRQGRVI

Conservation Score

0.09

PhyloCSF Frame 1

-4.16

No. of Spectra

11

CPC Coding Probability

0.307951

PhyloCSF Frame 2 

-4.223

CNTI Index

noncoding

Max Probability

0.9743

PhyloCSF Frame 3

-3.703

CNTI Score

-0.324166705