McDonnell Genome Institute

Washington University

Transcript

lnc-TGIF1-4:1

Chromosome

chr18

Gene Name

lnc-TGIF1-4

Start

3394888

CPC Label

noncoding

End

3395312

Cancer

OSCC

Strand

+

Peptide

LVTLFPPSSEEFQANK

Modified Peptide

n[145]LVTLFPPSSEEFQANK

Peptide Length

16

ORF Length

117

Open Reading Frame (ORF)

LSHMFGSKTQPTVLGKPKAPRLVTLFPPSSEEFQANKATLVCLMNDFYLGTVTVAWKADGIIITQDVETTKPPKQSKKQASSYLSLMPEQWRSRSSYNCWAMHKRSTLEKTMAHTEC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.131937

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8805

PhyloCSF Frame 3

0

CNTI Score

0.69680178